Overview

  • Product name

    Anti-SFT2D2 antibody
  • Description

    Rabbit polyclonal to SFT2D2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human SFT2D2 aa 1-36.
    Sequence:

    MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKG


    Database link: O95562

  • Positive control

    • WB: Mouse liver, kidney and thymus lysates. ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as SFT2B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab236899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 18 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-SFT2D2 antibody (ab236899) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate
    Lane 3 : Mouse thymus tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 18 kDa

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for SFT2D2 (green) using ab236899 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up