Overview

  • Product name

  • Description

    Rabbit polyclonal to SFXN1/TCC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Sheep, Cow, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse SFXN1/TCC aa 2-102. (Expressed in E.coli).
    Sequence:

    SGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVV HDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNM T


    Database link: Q99JR1

  • Positive control

    • WB: Recombinant mouse SFXN1/TCC protein; Mouse liver lysate. IHC-P: Mouse kidney tissue.
  • General notes

     This product was previously labelled as SFXN1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 36 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-SFXN1/TCC antibody (ab231256) at 1 µg + Mouse liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/1000 dilution

    Predicted band size: 36 kDa

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for SFXN1/TCC with ab231256 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SFXN1/TCC antibody (ab231256) at 2 µg/ml + Recombinant mouse SFXN1/TCC protein

    Predicted band size: 36 kDa

References

ab231256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up