Overview

  • Product name

  • Description

    Rabbit polyclonal to SGK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human SGK3 aa 40-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQ R


    Database link: Q96BR1

  • Positive control

    • Human breast carcinoma and kidney tissues; Mouse pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Involved in the activation of potassium channels. Mediates cell IL-3-dependent survival signals.
  • Tissue specificity

    Expressed in most tissues with highest levels in pancreas, kidney liver, heart and brain and lower levels in lung, placenta and skeletal muscle.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
    Contains 1 PX (phox homology) domain.
  • Cellular localization

    Cytoplasmic vesicle. Early endosome. Localized in vesicle-like structures and in the early endosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • CISK antibody
    • Cytokine independent survival kinase antibody
    • DKFZp781N0293 antibody
    • Serine/threonine protein kinase Sgk3 antibody
    • Serine/threonine-protein kinase Sgk3 antibody
    • Serum/glucocorticoid regulated kinase 3 antibody
    • Serum/glucocorticoid regulated kinase family member 3 antibody
    • Serum/glucocorticoid regulated kinase like antibody
    • Serum/glucocorticoid-regulated kinase 3 antibody
    • Serum/glucocorticoid-regulated kinase-like antibody
    • SGK 2 antibody
    • SGK 3 antibody
    • SGK2 antibody
    • Sgk3 antibody
    • SGK3_HUMAN antibody
    • SGKL antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast carcinoma tissue labeling SGK3 with ab218251 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling SGK3 with ab218251 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse pancreas tissue labeling SGK3 with ab218251 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up