Overview

  • Product name

  • Description

    Rabbit polyclonal to SH2D3A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SH2D3A aa 432-528.
    Sequence:

    WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLL EGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN


    Database link: Q9BRG2

  • Positive control

    • WB: RT-4 and U-251 MG cell lysate. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2500. Predicted molecular weight: 63 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May play a role in JNK activation.
  • Tissue specificity

    Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung.
  • Sequence similarities

    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine.
  • Information by UniProt
  • Database links

  • Alternative names

    • Novel SH2 containing protein 1 antibody
    • Novel SH2-containing protein 1 antibody
    • NSP1 antibody
    • SH2 domain containing 3A antibody
    • SH2 domain containing protein 3A antibody
    • SH2 domain-containing protein 3A antibody
    • SH23A_HUMAN antibody
    • SH2D3A antibody
    see all

Images

  • All lanes : Anti-SH2D3A antibody (ab221452) at 1/1000 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 63 kDa

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized A431 cells labeling SH2D3A with ab221452 at 4 μg/mL dilution (green). 

References

ab221452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up