Overview

  • Product name

  • Description

    Rabbit polyclonal to SH2D3A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SH2D3A aa 136-228.
    Sequence:

    IEPLRARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSSDPVLL KAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERP


    Database link: Q9BRG2

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 52,63 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in JNK activation.
  • Tissue specificity

    Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung.
  • Sequence similarities

    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine.
  • Information by UniProt
  • Database links

  • Alternative names

    • Novel SH2 containing protein 1 antibody
    • Novel SH2-containing protein 1 antibody
    • NSP1 antibody
    • SH2 domain containing 3A antibody
    • SH2 domain containing protein 3A antibody
    • SH2 domain-containing protein 3A antibody
    • SH23A_HUMAN antibody
    • SH2D3A antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for SH2D3A using ab224154 at 1/20 dilution in immunohistochemical analysis.

  • Anti-SH2D3A antibody (ab224154) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 52,63 kDa

References

ab224154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up