Anti-SH3BP5 antibody (ab222860)
Key features and details
- Rabbit polyclonal to SH3BP5
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SH3BP5 antibody
See all SH3BP5 primary antibodies -
Description
Rabbit polyclonal to SH3BP5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human SH3BP5 aa 49-455.
Sequence:LEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELVKKIGKAVEDS KPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDK RQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLE KKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALK NLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVA SEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLD LPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKA NNNRGLSSSSGSGGSSKSQSSTSPEGQALENRMKQLSLQCSKGRDGIIAD IKMVQIG
Database link: O60239 -
Positive control
- WB: Mouse heart, brain and kidney lysates. IHC-P: Human ovarian cancer tissue. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab222860 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
WB | 1/2000 - 1/5000. Detects a band of approximately 51 kDa (predicted molecular weight: 51 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death. -
Tissue specificity
Highly expressed in testis and ovaries. It is also expressed in a variety of tissues including spleen, lymph node, thymus, bone marrow, fetal liver, colon, small intestine and prostate. -
Sequence similarities
Belongs to the SH3BP5 family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 9467 Human
- Entrez Gene: 24056 Mouse
- Entrez Gene: 79566 Mouse
- Entrez Gene: 117186 Rat
- Omim: 605612 Human
- SwissProt: O60239 Human
- SwissProt: Q99LH9 Mouse
- SwissProt: Q9Z131 Mouse
see all -
Alternative names
- 3BP5_HUMAN antibody
- OTTHUMP00000208289 antibody
- OTTHUMP00000208291 antibody
see all
Images
-
All lanes : Anti-SH3BP5 antibody (ab222860) at 1/2000 dilution
Lane 1 : Mouse heart lysate
Lane 2 : Mouse brain lysate
Lane 3 : Mouse kidney lysate
Predicted band size: 51 kDa
Observed band size: 51 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SH3BP5 antibody (ab222860)
Paraffin-embedded human ovarian cancer tissue stained for SH3BP5 using ab222860 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SH3BP5 (green) using ab222860 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L).
Protocols
References (0)
ab222860 has not yet been referenced specifically in any publications.