Overview

  • Product name

  • Description

    Rabbit polyclonal to SH3GL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SH3GL2 aa 1-270.
    Sequence:

    MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEI MTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKF GRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKD LREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQ PRREYQPKPRMSLEFPTGDS


    Database link: Q99962

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 40 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificity

    Brain, mostly in frontal cortex. Expressed at high level in fetal cerebellum.
  • Sequence similarities

    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Domain

    An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes. The BAR domain dimer forms a rigid crescent shaped bundle of helices with the pair of second amphipathic helices protruding towards the membrane-binding surface.
  • Cellular localization

    Cytoplasm. Membrane. Concentrated in presynaptic nerve terminals in neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA335L15.1 (SH3 domain GRB2 like 2) antibody
    • CNSA2 antibody
    • EEN B1 antibody
    • EEN-B1 antibody
    • Endophilin 1 antibody
    • Endophilin A1 antibody
    • Endophilin A1 BAR domain antibody
    • Endophilin-1 antibody
    • Endophilin-A1 antibody
    • FLJ20276 antibody
    • FLJ25015 antibody
    • OTTHUMP00000021084 antibody
    • SH3 domain containing GRB2 like protein 2 antibody
    • SH3 domain GRB2 like 2 antibody
    • SH3 domain protein 2A antibody
    • SH3 domain-containing GRB2-like protein 2 antibody
    • SH3D2A antibody
    • SH3G2_HUMAN antibody
    • Sh3gl2 antibody
    • Sh3p4 antibody
    • SH3PA antibody
    see all

Images

  • Anti-SH3GL2 antibody (ab235337) at 1/1000 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human brain tissue stained for SH3GL2 with ab235337 at 1/100 dilution in immunohistochemical analysis.

References

ab235337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up