Overview

  • Product name

  • Description

    Rabbit polyclonal to SH3GLB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SH3GLB2 aa 1-250.
    Sequence:

    MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFE NLLARADSTKNWTEKILRQT EVLLQPNPSA RVEEFLYEKL DRKVPSRVTNGELLAQYMADAASELGPTTP YGKTLIKVAE AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLD ACKARLKKAKAAEAKATTVPDFQETRPRNY ILSASASALW NDEVDKAEQELRVAQTEFDRQAEVTRLLLE GISSTHVNHL


    Database link: Q9NR46

  • Positive control

    • WB: Mouse liver lysate. IHC-P: Human prostate tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 44 kDa (predicted molecular weight: 44 kDa).
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Detected in skeletal muscle, adipocyte, brain, lung, colon and mammary gland.
  • Sequence similarities

    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endophilin B2 antibody
    • Endophilin-B2 antibody
    • OTTHUMP00000022320 antibody
    • PP6569 antibody
    • PP9455 antibody
    • Retinoid receptor induced gene 1 antibody
    • RRIG1 antibody
    • SH3 containing protein SH3GLB2 antibody
    • SH3 domain GRB2 like endophilin B2 antibody
    • SH3 domain-containing GRB2-like protein B2 antibody
    • SH3GLB2 antibody
    • SHLB2_HUMAN antibody
    see all

Images

  • Anti-SH3GLB2 antibody (ab229981) at 1/1000 dilution + Mouse liver lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 44 kDa
    Observed band size: 44 kDa

  • Paraffin-embedded human prostate tissue stained for SH3GLB2 using ab229981 at 1/100 dilution in immunohistochemical analysis.

References

ab229981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up