Overview

  • Product name

  • Description

    Rabbit polyclonal to SHANK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to Human SHANK2 aa 331-380. NCBI Accession No. NP_036441.2
    Sequence:

    NTALHICALYNQDSCARVLLFRGGNKELKNYNSQTPFQVAIIAGNFELA


    Database link: Q9UPX8-3

  • Positive control

    • Human intestine tissue and mouse RAW 264.7, Jurkat, HepG2 and COLO 205 cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    PBS without Mg2+, Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 20 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 201 kDa.

Target

  • Function

    Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.
  • Tissue specificity

    Expressed in epithelial cells (at protein level). All isoforms except isoform 7 are expressed predominantly in brain, with highest levels in olfactory bulb, cerebral cortex, cerebellum, central gray matter and hippocampus. Moderate levels of expression are seen in the caudate putamen, thalamic nuclei and brain stem. In cerebellum primarily expressed in Purkinje cells. Isoform 7 is not expressed in brain but expressed in liver, cholangiocytes and thymus. Isoform 7 is present in pancreas, colonic mucosa and thymocytes (at protein level).
  • Sequence similarities

    Belongs to the SHANK family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH3 domain.
  • Developmental stage

    Expressed during early postnatal brain development, especially in the caudate putamen and thalamic nuclei. Expression in the cerebral cortex, the hippocampus and the cerebellum is moderate to high at P5 and shows a stable expression throughout development. Isoforms 1, 2, 4 and 6 are predominantly expressed in cerebellum up to the age of approximately 3 weeks. Isoform 1 expression decreases during development of cortex but slightly increases in cerebellum.
  • Domain

    The PDZ domain is required for interaction with GRID2, PLCB3, SLC9A3 and CFTR.
  • Cellular localization

    Apical cell membrane. Cytoplasm. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, growth cone. Cell projection, dendritic spine. Colocalizes with cortactin in growth cones in differentiating hippocampal neurons. Present in the dendritic spines of cerebellar Purkinje cells (By similarity). Colocalizes with cortactin in growth cones in differentiating hippocampal neurons. Colocalized with PDE4D to the apical membrane of colonic crypt cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • AUTS17 antibody
    • Cortactin binding protein 1 antibody
    • Cortactin SH3 domain-binding protein antibody
    • Cortactin-binding protein 1 antibody
    • CortBP1 antibody
    • CTTNBP1 antibody
    • GKAP/SAPAP interacting protein antibody
    • GKAP/SAPAP-interacting protein antibody
    • KIAA1022 antibody
    • Proline rich synapse associated protein 1 antibody
    • Proline-rich synapse-associated protein 1 antibody
    • ProSAP1 antibody
    • SH3 and multiple ankyrin repeat domains 2 antibody
    • SH3 and multiple ankyrin repeat domains protein 2 antibody
    • SHAN2_RAT antibody
    • SHANK antibody
    • Shank2 antibody
    • SPANK-3 antibody
    see all

Images

  • All lanes : Anti-SHANK2 antibody (ab189398) at 1/500 dilution

    Lane 1 : mouse RAW 264.7 cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : COLO 205 cell lysate
    Lane 5 : mouse RAW 264.7 cell lysate with the synthesized peptide

    Predicted band size: 201 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human intestine tissue labeling SHANK2 using ab189398 at 20 µg/ml

References

ab189398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up