Overview

  • Product name

  • Description

    Rabbit polyclonal to SHARPIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SHARPIN aa 1-230 (N terminal).
    Sequence:

    MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADP ERPGRFRL ELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGT LSLHFLNPQEAQRWAVLVR GATVEGQNGSKSNSPPALGPEACPVSLPS PPEASTLKGPPPEADLPRSPGNLTEREELAG SLARAIAGGDEKGAAQV AAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAAS


    Database link: Q9H0F6

  • Positive control

    • Sharpin transfected U2OS cells and lysates, U2OS cell extracts, NIH3T3 cell lysate,

Properties

Applications

Our Abpromise guarantee covers the use of ab197853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
WB 1/2000. Predicted molecular weight: 40 kDa.
Flow Cyt 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/2000.

Target

  • Function

    May have a role in normal immune development and control of inflammation.
  • Tissue specificity

    Highly expressed in skeletal muscle and placenta and at lower levels in brain, heart, colon without mucosa, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 RanBP2-type zinc finger.
  • Cellular localization

    Cytoplasm. Enriched at synaptic sites in mature neurons where it colocalizes with SHANK1.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434N1923 antibody
    • hSIPL1 antibody
    • Shank associated RH domain interacting protein antibody
    • SHANK associated RH domain interactor antibody
    • Shank interacting protein like 1 antibody
    • Shank-associated RH domain-interacting protein antibody
    • Shank-interacting protein-like 1 antibody
    • Sharpin antibody
    • SHRPN_HUMAN antibody
    • SIPL1 antibody
    see all

Images

  • All lanes : Anti-SHARPIN antibody (ab197853) at 1/2000 dilution

    Lane 1 : Control siRNA transfected U2OS cell lysate
    Lane 2 : Sharpin siRNA transfected U2OS cell lysate
    Lane 3 : NIH3T3 cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 40 kDa



    Transfer in nitrocelullose, block: 1 hour 5% milk in TBST, incubation with primary antibody o/n @ 4oC in 5% milk TBST (0.1% Tween).

  • Western blot analysis with ab197853 of Immunoprecipitation
    using U2OS cells extracts
    Lane 1: Input.
    Lane 2: Immunoprecipitation with control serum.
    Lane 3: Immunoprecipitation with ab197853 (5μl)

  • Flow cytometric analysis of U2OS cells labeling Sharpin with ab197853 at 1/200 dilution. Upper panel shows labeling wit IgG controls, middle panel shows labeling of control siRNA treated cells and bottom panel shows labeling of Sharpin siRNA treated cells.  Cells were fixed with 1% PFA. Cells were incubated with the primary antibody overnight at 4°C.

  • Immunofluorescent analysis of PFA fixed and methanol permeabilizaed U2OS cells transfected with HA-Sharpin labeling Sharpin with ab197853 at 1/200 dilution in PBST (green) and HA in (red)

References

This product has been referenced in:

  • Tang L  et al. Down-regulated SHARPIN may accelerate the development of atopic dermatitis through activating interleukin-33/ST2 signalling. Exp Dermatol N/A:N/A (2018). WB ; Human . Read more (PubMed: 30230040) »
  • Fu T  et al. A novel SHARPIN-PRMT5-H3R2me1 axis is essential for lung cancer cell invasion. Oncotarget 8:54809-54820 (2017). WB ; Human . Read more (PubMed: 28903384) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up