Overview

  • Product name

  • Description

    Rabbit polyclonal to SHARPIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SHARPIN aa 82-171.
    Sequence:

    RGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNS PPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTE


    Database link: Q9H0F6

  • Positive control

    • WB: HeLa, Jurkat, A549 and L02 whole cell lysates. IHC-P: Human skeletal muscle and prostate cancer tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 40 kDa.
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May have a role in normal immune development and control of inflammation.
  • Tissue specificity

    Highly expressed in skeletal muscle and placenta and at lower levels in brain, heart, colon without mucosa, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 RanBP2-type zinc finger.
  • Cellular localization

    Cytoplasm. Enriched at synaptic sites in mature neurons where it colocalizes with SHANK1.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434N1923 antibody
    • hSIPL1 antibody
    • Shank associated RH domain interacting protein antibody
    • SHANK associated RH domain interactor antibody
    • Shank interacting protein like 1 antibody
    • Shank-associated RH domain-interacting protein antibody
    • Shank-interacting protein-like 1 antibody
    • Sharpin antibody
    • SHRPN_HUMAN antibody
    • SIPL1 antibody
    see all

Images

  • All lanes : Anti-SHARPIN antibody (ab236092) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : L02 (human immortal liver cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human skeletal muscle tissue stained for SHARPIN using ab236092 at 1/500 dilution in immunohistochemical analysis. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human prostate cancer tissue stained for SHARPIN using ab236092 at 1/500 dilution in immunohistochemical analysis. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • 4% paraformaldehyde-fixed, 0.2% Triton X-100 permeabilized PC-3 (human epithelial cell line from cervix adenocarcinoma) cells stained for SHARPIN (green) using ab236092 at 1/166 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up