Overview

  • Product name

  • Description

    Rabbit polyclonal to SHC3/SHCC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human SHC3/SHCC aa 359-408 (internal sequence).
    Sequence:

    RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST


    Database link: NP_058544

  • Positive control

    • HepG2 cell lysate
  • General notes

     This product was previously labelled as SHC3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab97972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.
  • Tissue specificity

    Mainly expressed in brain. Hardly detectable in other tissues, except in pancreas. Highly expressed in the cerebral cortex, frontal and temporal lobes, occipital pole, hippocampus, caudate nucleus and amygdala. Expressed at low level in the cerebellum, medulla and spinal cord.
  • Sequence similarities

    Contains 1 PID domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • N SHC antibody
    • N-Shc antibody
    • Neuronal Shc antibody
    • NSHC antibody
    • Protein Rai antibody
    • Rai antibody
    • SH2 domain protein C3 antibody
    • SHC (Src homology 2 domain containing) transforming protein 3 antibody
    • SHC adaptor protein 3 antibody
    • SHC protein C antibody
    • SHC-like protein, neuronal antibody
    • SHC-transforming protein 3 antibody
    • SHC-transforming protein C antibody
    • Shc3 antibody
    • Shc3 p51 antibody
    • SHC3_HUMAN antibody
    • SHCC antibody
    • Src homology 2 domain-containing transforming protein antibody
    • Src homology 2 domain-containing-transforming protein C3 antibody
    see all

Images

  • Anti-SHC3/SHCC antibody (ab97972) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 64 kDa



    Gel concentration: 12%

References

ab97972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up