Overview

  • Product name

    Anti-SHC4/SHCD antibody
  • Description

    Rabbit polyclonal to SHC4/SHCD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SHC4/SHCD aa 76-132.
    Sequence:

    SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDP GSSGPSS


    Database link: Q6S5L8

  • Positive control

    • ICC/IF: SK-MEL-30 cells.
  • General notes

     This product was previously labelled as SHC4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
  • Tissue specificity

    Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory competence and invasive potential.
  • Sequence similarities

    Contains 1 PID domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Phosphorylated; the phosphorylation is enhanced by EGF. Phosphorylation at Tyr-424 is required for the interaction with GRB2.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Colocalized with MUSK at the neuromuscular junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • hShcD antibody
    • MGC34023 antibody
    • Rai like protein antibody
    • Rai-like protein antibody
    • RaLP antibody
    • SH2 domain protein C4 antibody
    • SHC (Src homology 2 domain containing) family member 4 antibody
    • SHC 4 antibody
    • SHC adaptor protein 4 antibody
    • SHC antibody
    • SHC family member 4 antibody
    • SHC transforming protein 4 antibody
    • SHC transforming protein D antibody
    • SHC-transforming protein 4 antibody
    • SHC-transforming protein D antibody
    • Shc4 antibody
    • SHC4_HUMAN antibody
    • SHCD antibody
    • Src homology 2 domain containing family member 4 antibody
    • Src homology 2 domain containing transforming protein C4 antibody
    • Src homology 2 domain-containing-transforming protein C4 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells stained for SHC4/SHCD (green) using ab221996 at 4 µg/ml in ICC/IF.

References

ab221996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up