Overview

  • Product name

    Anti-SHCBP1L antibody
  • Description

    Rabbit polyclonal to SHCBP1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SHCBP1L aa 110-208.
    Sequence:

    CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLG VWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF


    Database link: Q9BZQ2

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Highly expressed in the testis.
  • Sequence similarities

    Contains 4 PbH1 repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700012A16Rik antibody
    • C1orf14 antibody
    • GE36 antibody
    • RGD1305609 antibody
    • RP5-1133A12.2 antibody
    • SHC binding and spindle associated 1 like antibody
    • SHC SH2 domain-binding protein 1-like protein antibody
    • SHCBP1L antibody
    • SHP1L_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for SHCBP1L using ab224505 at 1/200 dilution in immunohistochemical analysis.

References

ab224505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up