Overview

  • Product name

  • Description

    Rabbit polyclonal to SHISA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse SHISA4 aa 28-197. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    SEDCLWYLDRNGSWHPGFDCEFFTFCCGTCYQRYCCRDLTLLITERQQKH CLAFSPKTIAGIASAVILFVAVVATTICCFLCSCCYLYRRRQQLQSTFEG QEIPMTGIPMQPVYQYPPDPKAGPAPPQPGFMYPPSGPAPQYPLYPAGPP IYNPAAPPPYMPPQPSYPGA


    Database link: Q8CA71

  • Positive control

    • IHC-P: Mouse stomach tissue. WB: Recombinant mouse SHISA4 protein; Rat and mouse cerebrum lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for SHISA4 using ab233400 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-SHISA4 antibody (ab233400) at 1 µg/ml

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Rat brain tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Anti-SHISA4 antibody (ab233400) at 1 µg/ml + Mouse cerebrum tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Anti-SHISA4 antibody (ab233400) at 2 µg/ml + Recombinant mouse SHISA4 protein.

References

ab233400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up