Overview

  • Product name

  • Description

    Rabbit polyclonal to SHISA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human SHISA4 aa 28-197. Mature chain. Expressed in E.coli. N-terminal tags.
    Sequence:

    GEDCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKH CLAFSPKTIAGIASAVILFVAVVATTICCFLCSCCYLYRRRQQLQSPFEG QEIPMTGIPVQPVYPYPQDPKAGPAPPQPGFIYPPSGPAPQYPLYPAGPP VYNPAAPPPYMPPQPSYPGA


    Database link: Q96DD7

  • Positive control

    • WB: Recombinant human SHISA4 protein; Mouse pancreas, cerebrum and kidney lysates; Rat cerebrum and kidney lysates. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for SHISA4 using ab233436 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SHISA4 antibody (ab233436) at 1 µg/ml + Mouse pancreas lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 22 kDa

  • Anti-SHISA4 antibody (ab233436) at 1 µg/ml + Mouse cerebrum lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 22 kDa

  • Anti-SHISA4 antibody (ab233436) at 1 µg/ml + Rat cerebrum lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 22 kDa

  • Anti-SHISA4 antibody (ab233436) at 1 µg/ml + Mouse kidney lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 22 kDa

  • Anti-SHISA4 antibody (ab233436) at 1 µg/ml + Rat kidney lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 22 kDa

  • Anti-SHISA4 antibody (ab233436) at 2 µg/ml + Recombinant human SHISA4 protein

    Predicted band size: 22 kDa

References

ab233436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up