Anti-SHK antibody (ab247151)
Key features and details
- Rabbit polyclonal to SHK
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SHK antibody
See all SHK primary antibodies -
Description
Rabbit polyclonal to SHK -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SHK aa 65-165.
Sequence:ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITP VFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKY R
Database link: Q9UHJ6 -
Positive control
- IHC-P: Human kidney and pancreas tissues. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab247151 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Tissue specificity
Strongly expressed in liver, kidney and pancreas. Expressed at lower levels in placenta and heart. Very weakly expressed in lung and brain. -
Sequence similarities
Belongs to the FGGY kinase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23729 Human
- Omim: 605060 Human
- SwissProt: Q9UHJ6 Human
- Unigene: 579217 Human
-
Alternative names
- Carbohydrate kinase like antibody
- Carbohydrate kinase like protein antibody
- Carbohydrate kinase-like protein antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SHK antibody (ab247151)
PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling SHK using ab247151 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SHK antibody (ab247151)Paraffin-embedded human kidney tissue stained for SHK using ab247151 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SHK antibody (ab247151)Paraffin-embedded human pancreas tissue stained for SHK using ab247151 at 1/200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247151 has not yet been referenced specifically in any publications.
