Anti-SHK antibody (ab247151)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SHK antibody
See all SHK primary antibodies -
Description
Rabbit polyclonal to SHK -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SHK aa 65-165.
Sequence:ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITP VFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKY R
Database link: Q9UHJ6 -
Positive control
- IHC-P: Human kidney and pancreas tissues. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab247151 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Tissue specificity
Strongly expressed in liver, kidney and pancreas. Expressed at lower levels in placenta and heart. Very weakly expressed in lung and brain. -
Sequence similarities
Belongs to the FGGY kinase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23729 Human
- Omim: 605060 Human
- SwissProt: Q9UHJ6 Human
- Unigene: 579217 Human
-
Alternative names
- Carbohydrate kinase like antibody
- Carbohydrate kinase like protein antibody
- Carbohydrate kinase-like protein antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SHK antibody (ab247151)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling SHK using ab247151 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SHK antibody (ab247151)Paraffin-embedded human kidney tissue stained for SHK using ab247151 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SHK antibody (ab247151)Paraffin-embedded human pancreas tissue stained for SHK using ab247151 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab247151 has not yet been referenced specifically in any publications.
