Overview

  • Product name

  • Description

    Rabbit polyclonal to SHMT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human SHMT1 aa 453-483 (C terminal). The exact sequence is proprietary. (NP_004160.3).
    Sequence:

    AGDKYQAAVQALREEVESFASLFPLPGLPDF


    Database link: P34896

  • Positive control

    • Jurkat and NIH 3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab186130 was affinity purified using an epitope specific to SHMT1 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/500 - 1/2500. Predicted molecular weight: 53 kDa.

Target

Images

  • Anti-SHMT1 antibody (ab186130) at 1 µg/ml + Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 3 minutes
  • Anti-SHMT1 antibody (ab186130) at 1 µg/ml + NIH 3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 3 minutes
  • Detection of SHMT1 in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186130 at 6 µg per reaction for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up