Overview

  • Product name

  • Description

    Rabbit polyclonal to SHMT2/SHMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human SHMT2/SHMT aa 17-88.
    Sequence:

    GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDR QCRGLELIASENFCSRAALEAL


    Database link: P34897

  • Positive control

    • WB: SK-MEL-30, NIH/3T3 and NBT-II cell lysates. IHC-P: Human lymph node, kidney, liver, colon, and skin tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as SHMT2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 56 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA.
  • Pathway

    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities

    Belongs to the SHMT family.
  • Cellular localization

    Mitochondrion. Mitochondrion matrix > mitochondrion nucleoid. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epididymis secretory sperm binding protein Li 51e antibody
    • GLY A+ antibody
    • GLYA antibody
    • glycine auxotroph A, human complement for hamster antibody
    • Glycine hydroxymethyltransferase antibody
    • GLYM_HUMAN antibody
    • HEL S 51e antibody
    • mitochondrial antibody
    • Serine hydroxymethyltransferase 2 (mitochondrial) antibody
    • Serine hydroxymethyltransferase antibody
    • Serine hydroxymethyltransferase mitochondrial antibody
    • Serine methylase antibody
    • SHMT 2 antibody
    • SHMT antibody
    • SHMT2 antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for SHMT2/SHMT using ab224427 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for SHMT2/SHMT using ab224427 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver node tissue stained for SHMT2/SHMT using ab224427 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for SHMT2/SHMT using ab224427 at 1/200 dilution in immunohistochemical analysis.

  • Anti-SHMT2/SHMT antibody (ab224427) at 1/100 dilution + SK-MEL-30 cell lysate

    Predicted band size: 56 kDa

  • Paraffin-embedded human lymph node tissue stained for SHMT2/SHMT using ab224427 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-SHMT2/SHMT antibody (ab224427) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 56 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SHMT2/SHMT (green) using ab224427 at 4 µg/ml in ICC/IF.

References

ab224427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up