Overview

  • Product name

  • Description

    Rabbit polyclonal to SHMT2/SHMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rabbit, Cow
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human SHMT2/SHMT aa 30-504. Mature chain. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    NAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENF CSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDL DPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSD VKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYA RLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTH KTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHN HAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDN HLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAP ALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETS QRLANLRQRVEQFARAFPMPGFDEH


    Database link: P34897

  • Positive control

    • WB: Recombinant human SHMT2/SHMT protein; Human lung lysate; HEK-293T and HeLa cell lysates; Pig pancreas lysate. IHC-P: Human breast cancer, stomach, stomach cancer, rectum cancer, breast cancer, prostate and cerebrum tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as SHMT2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA.
  • Pathway

    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities

    Belongs to the SHMT family.
  • Cellular localization

    Mitochondrion. Mitochondrion matrix > mitochondrion nucleoid. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epididymis secretory sperm binding protein Li 51e antibody
    • GLY A+ antibody
    • GLYA antibody
    • glycine auxotroph A, human complement for hamster antibody
    • Glycine hydroxymethyltransferase antibody
    • GLYM_HUMAN antibody
    • HEL S 51e antibody
    • mitochondrial antibody
    • Serine hydroxymethyltransferase 2 (mitochondrial) antibody
    • Serine hydroxymethyltransferase antibody
    • Serine hydroxymethyltransferase mitochondrial antibody
    • Serine methylase antibody
    • SHMT 2 antibody
    • SHMT antibody
    • SHMT2 antibody
    see all

Images

  • Anti-SHMT2/SHMT antibody (ab233430) at 1 µg/ml + Recombinant human SHMT2/SHMT protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • All lanes : Anti-SHMT2/SHMT antibody (ab233430) at 1 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : Pig pancreas lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for SHNT2 using ab233430 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SHMT2/SHMT (green) using ab233430 at 20 μg/ml in ICC/IF. FITC staining.

References

ab233430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up