Overview

  • Product name

    Anti-Shoc2 / Sur8 antibody
    See all Shoc2 / Sur8 primary antibodies
  • Description

    Rabbit polyclonal to Shoc2 / Sur8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Shoc2/ Sur8 aa 3-89.
    Sequence:

    SSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKD GKKDSSAAQPGVAFSVDNTIKRPNPAPGTRKKSSNAE


    Database link: Q9UQ13

  • Positive control

    • WB: MCF7, Jurkat and HepG2 whole cell lysates. IHC-P: Human lung and brain tissues. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 65 kDa (predicted molecular weight: 65 kDa).
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes.
  • Involvement in disease

    Defects in SHOC2 are the cause of Noonan syndrome-like with loose anagen hair (NSLAH) [MIM:607721]. NSLAH children display macrocephaly, high forehead, hypertelorism, palpebral ptosis, low-set and posteriorly rotated ears, short and webbed neck and pectus anomalies. Affected subjects also have easily pluckable, sparse, thin and slow-growing hair.
  • Sequence similarities

    Belongs to the SHOC2 family.
    Contains 20 LRR (leucine-rich) repeats.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates from cytoplasm to nucleus upon growth factor stimulation.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0862 antibody
    • Leucine-rich repeat protein SHOC-2 antibody
    • Protein soc-2 homolog antibody
    • Protein Sur-8 homolog antibody
    • Ras-binding protein Sur-8 antibody
    • SHOC2 antibody
    • SHOC2_HUMAN antibody
    see all

Images

  • All lanes : Anti-Shoc2 / Sur8 antibody (ab229805) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 65 kDa
    Observed band size: 65 kDa

  • Paraffin-embedded human lung tissue stained for Shoc2 / Sur8 with ab229805 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for Shoc2 / Sur8 with ab229805 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Shoc2 / Sur8 (green) using ab229805 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

     

References

ab229805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up