Overview

  • Product name

  • Description

    Rabbit polyclonal to SHOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SHOX aa 50-105.
    Sequence:

    GTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKE KREDVK


    Database link: O15266

  • Positive control

    • BJ cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Controls fundamental aspects of growth and development.
  • Tissue specificity

    SHOXA is expressed in skeletal muscle, placenta, pancreas, heart and bone marrow fibroblast and SHOXB is highly expressed in bone marrow fibroblast followed by kidney and skeletal muscle. SHOXB is not expressed in brain, kidney, liver and lung. Highly expressed in osteogenic cells.
  • Involvement in disease

    Defects in SHOX are the cause of Leri-Weill dyschondrosteosis (LWD) [MIM:127300]. LWD is a dominantly inherited skeletal dysplasia characterized by moderate short stature predominantly because of short mesomelic limb segments. It is often associated with the Madelung deformity of the wrist, comprising bowing of the radius and dorsal dislocation of the distal ulna.
    Defects in SHOX are a cause of Langer mesomelic dysplasia (LMD) [MIM:249700]. LMD is an autosomal recessive rare skeletal dysplasia characterized by severe short stature owing to shortening and maldevelopment of the mesomelic and rhizomelic segments of the limbs. Associated malformations are rarely reported and intellect is normal in all affected subjects reported to date.
    Defects in SHOX are a cause of idiopathic short stature (ISS) [MIM:300582]. Idiopathic short stature is usually defined as a height below the third percentile for chronological age or minus 2 standard deviations of national height standards in the absence of specific causative disorders.
  • Sequence similarities

    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • GCFX antibody
    • Growth control factor, X linked antibody
    • Homo sapiens shox gene, alternatively spliced products, complete cds antibody
    • PHOG antibody
    • Pseudoautosomal homeobox containing osteogenic antibody
    • Pseudoautosomal homeobox containing osteogenic protein antibody
    • Pseudoautosomal homeobox-containing osteogenic protein antibody
    • Short stature homeobox antibody
    • Short stature homeobox containing protein antibody
    • Short stature homeobox protein antibody
    • Short stature homeobox-containing protein antibody
    • SHOX antibody
    • SHOX_HUMAN antibody
    • SHOXY antibody
    • SS antibody
    • Turner syndrome antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized BJ cells labeling SHOX with ab220886 at 4 µg/mL (green).

References

ab220886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up