Anti-SHOX2 antibody [1D1] (ab55740)
Key features and details
- Mouse monoclonal [1D1] to SHOX2
- Suitable for: WB, IHC-Fr
- Reacts with: Rat, Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-SHOX2 antibody [1D1]
See all SHOX2 primary antibodies -
Description
Mouse monoclonal [1D1] to SHOX2 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Frmore details -
Species reactivity
Reacts with: Rat, Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human SHOX2 aa 117-204.
Sequence:SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPD AFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Database link: O60902 -
Positive control
- WB: Human liver tissue lysat; PC-12 cell lysate
-
General notes
This product was changed from ascites to tissue culture supernatant on 16/Oct/2019. Lot numbers higher than GR3303529 are from tissue culture supernatant. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
1D1 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab55740 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 35 kDa.
|
|
IHC-Fr | (1) |
Use at an assay dependent concentration.
|
Notes |
---|
WB
Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 35 kDa. |
IHC-Fr
Use at an assay dependent concentration. |
Target
-
Function
May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation. -
Tissue specificity
Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta. -
Sequence similarities
Belongs to the paired homeobox family. Bicoid subfamily.
Contains 1 homeobox DNA-binding domain. -
Developmental stage
Expressed during cranofacial development as well as in heart. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6474 Human
- Entrez Gene: 25546 Rat
- Omim: 602504 Human
- SwissProt: O60902 Human
- SwissProt: O35750 Rat
- Unigene: 55967 Human
- Unigene: 11258 Rat
-
Alternative names
- Homeobox protein Og12X antibody
- OG 12 antibody
- OG 12X antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab55740 has been referenced in 15 publications.
- Yin L et al. RA signaling pathway combined with Wnt signaling pathway regulates human-induced pluripotent stem cells (hiPSCs) differentiation to sinus node-like cells. Stem Cell Res Ther 13:324 (2022). PubMed: 35851424
- Wiesinger A et al. A single cell transcriptional roadmap of human pacemaker cell differentiation. Elife 11:N/A (2022). PubMed: 36217819
- Li J et al. Molecular and electrophysiological evaluation of human cardiomyocyte subtypes to facilitate generation of composite cardiac models. J Tissue Eng 13:20417314221127908 (2022). PubMed: 36277058
- Ye F et al. TNF-α suppresses SHOX2 expression via NF-κB signaling pathway and promotes intervertebral disc degeneration and related pain in a rat model. J Orthop Res 39:1745-1754 (2021). PubMed: 32816304
- Baudouin C et al. Generation and characterization of a tamoxifen-inducible Vsx1-CreERT2 line to target V2 interneurons in the mouse developing spinal cord. Genesis 59:e23435 (2021). PubMed: 34080769