Overview

  • Product name

  • Description

    Rabbit polyclonal to SHOX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 179 - 228 (SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGAL R) of Human SHOX2, (NP_006875)

  • Positive control

    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab82918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

Target

  • Function

    May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
  • Tissue specificity

    Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
  • Sequence similarities

    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Expressed during cranofacial development as well as in heart.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein Og12X antibody
    • OG 12 antibody
    • OG 12X antibody
    • OG12 antibody
    • OG12X antibody
    • OGI 2X antibody
    • OGI2X antibody
    • Paired related homeobox protein SHOT antibody
    • Paired-related homeobox protein SHOT antibody
    • Short stature homeobox 2 antibody
    • Short stature homeobox homolog antibody
    • Short stature homeobox protein 2 antibody
    • SHOT antibody
    • SHOX 2 antibody
    • SHOX homologous gene on chromosome 3 antibody
    • SHOX2 antibody
    • SHOX2_HUMAN antibody
    see all

Images

  • Anti-SHOX2 antibody (ab82918) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 35 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 20 kDa. We are unsure as to the identity of these extra bands.

  • All lanes : Anti-SHOX2 antibody (ab82918) at 1 µg/ml

    Lane 1 : Marker
    Lane 2 : Zebrafish brain homogenate at 20 µg
    Lane 3 : Zebrafish heart homogenate at 20 µg
    Lane 4 : Zebrafish liver homogenate at 20 µg

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 35 kDa
    Observed band size: 41 kDa why is the actual band size different from the predicted?


    Exposure time: 5 minutes

References

ab82918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Cell lysate - whole cell (ATDC5 cell lines-chondrocyte)
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris)
Loading amount
25 µg
Specification
ATDC5 cell lines-chondrocyte
Blocking step
Odyssey Blocking Buffer (PBS) as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 24 2019

Application
Western blot
Sample
Mouse Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing (12%)
Loading amount
250 µg
Specification
Heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 09 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up