Overview

  • Product name

  • Description

    Rabbit polyclonal to SIA8D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 394-443 (

    GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA

    ) of rat SIA8D (NP_446366).

  • Positive control

    • Rat testis lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab133921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function

    Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
  • Tissue specificity

    Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8-sialyltransferase 8D antibody
    • 8-sialyltransferase antibody
    • Alpha 2 8 sialyltransferase 8D antibody
    • Alpha-2 antibody
    • CMP N acetylneuraminate poly alpha 2 8 sialyl transferase antibody
    • CMP-N-acetylneuraminate-poly-alpha-2 antibody
    • Polysialyltransferase 1 antibody
    • Polysialyltransferase-1 antibody
    • PST antibody
    • PST1 antibody
    • SIA8D_HUMAN antibody
    • Sialyltransferase 8 alpha 2 8 polysialytransferase D antibody
    • Sialyltransferase 8D antibody
    • Sialytransferase St8Sia IV antibody
    • SIAT8-D antibody
    • SIAT8D antibody
    • ST8 alpha N acetyl neuraminide alpha 2 8 sialyltransferase 4 antibody
    • ST8Sia IV antibody
    • ST8SIA4 antibody
    • ST8SiaIV antibody
    see all

Images

  • Anti-SIA8D antibody (ab133921) at 1 µg/ml + Rat testis lysate at 10 µg

    Predicted band size: 52 kDa

References

ab133921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up