Overview

  • Product name

    Anti-SIDT2 antibody
  • Description

    Rabbit polyclonal to SIDT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 72-121 of Human SIDT2 (

    LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT

    ) NP_001035545

  • Positive control

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-SIDT2 antibody (ab85847) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 94 kDa
    Observed band size: 94 kDa



    Gel concentration: P6%-18%

References

This product has been referenced in:

  • Long OS  et al. A C. elegans model of human a1-antitrypsin deficiency links components of the RNAi pathway to misfolded protein turnover. Hum Mol Genet N/A:N/A (2014). Human . Read more (PubMed: 24838286) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up