Overview

  • Product name

    Anti-SIGLEC H antibody [ABM2B55]
    See all SIGLEC H primary antibodies
  • Description

    Rat monoclonal [ABM2B55] to SIGLEC H
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse SIGLEC H aa 109-309.
    Sequence:

    LDIRDAQKGDNGSYFFRLEKGGKTWNFCEERISVHVTDLTHSPNISIPQT LELGRPTNVMCSVPWACERGTPPIFSWMSAALISLGPTTTLSSVLTLTPR LQDHGTNLTCQVTFPGAGVTVQKTIQLNVTYNSQNSTAHVSGRVGPGKPR PLADVVQVAMGEAAIKFLLLGICFFFLSKRSHTKRVERPATHMDQAHAVM D


    Database link: Q3Y597

  • Positive control

    • WB: Mouse skeletal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab228448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    SIGLEC H a cell-surface receptor molecule selectively expressed on murine natural interferon producing cells (IPC), also called mouse plasmacytoid dendritic cells (pDC). Siglec H is unique among Sialic acid-binding Ig-like lectins (Siglecs) proteins because it associates with the adaptor protein DAP12. DAP12 recognize certain viruses and CpG-DNA through TLR9, resulting in secretion of IFN-alpha, IL-12 and proinflammatory chemokines. Together these cytokines and chemokines recruite and activate NK cells and T cells as well as modulating the antigen presenting function of dendritic cells (DC). IPC themselves also function as antigen presenting cells that expand memory T cells and induce Th1 differentiation. Therefore IPC may provide a first line of host defense against viral infections by activating both innate and adaptive responses in vivo. The monoclonal antibody 440c exclusively recognizes mouse Siglec-H in all lymphoid organs under both normal and inflammatory conditions. Siglec-H is normal present in the T cell zone of lymph nodes and spleen.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • sialic acid binding Ig like lectin H antibody
    • SIGLEC like protein antibody
    • Siglech antibody

Images

  • Anti-SIGLEC H antibody [ABM2B55] (ab228448) at 2 µg/ml + Mouse skeletal muscle lysate

    Predicted band size: 34 kDa

References

ab228448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up