Overview

  • Product name

  • Description

    Rabbit polyclonal to SIGLEC14
  • Host species

    Rabbit
  • Specificity

    Expected cross reactivity with SIGLEC5, 100%.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human SIGLEC14 aa 24-137. Expressed in E. coli. N-terminal His-tag and S-tag.
    Sequence:

    QVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYAEVV ATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERG RDVKYSYQQNKLNL


    Database link: Q08ET2

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human SIGLEC14 protein. Rat small intestine lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Putative adhesion molecule. Sialic acid-binding paired receptor which may activate associated receptors.
  • Tissue specificity

    Mainly expressed in hematopoietic tissues including bone marrow, spleen and fetal liver. Also detected in lung and testis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Sialic acid binding Ig like lectin 14 antibody
    • Sialic acid-binding Ig-like lectin 14 antibody
    • SIG14_HUMAN antibody
    • Siglec 14 antibody
    • Siglec-14 antibody
    • SIGLEC14 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for SIGLEC14 with ab233299 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SIGLEC14 antibody (ab233299) at 1 µg/ml + Rat small intestine tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-SIGLEC14 antibody (ab233299) at 1 µg/ml + Recombinant human SIGLEC14 protein

References

ab233299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up