Overview

  • Product name

  • Description

    Rabbit polyclonal to SIGLEC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SIGLEC6 aa 53-176.
    Sequence:

    LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRK NCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISI PGTLESGHPSNLTCSVPWVCEQGT


    Database link: O43699

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500.

Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. 

Target

  • Function

    Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
  • Tissue specificity

    Expressed at high levels in placenta (cyto- and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD327 antibody
    • CD33 antigen-like 1 antibody
    • CD33L antibody
    • CD33L1 antibody
    • CD33L2 antibody
    • CDw327 antibody
    • OB-BP1 antibody
    • OBBP1 antibody
    • Obesity-binding protein 1 antibody
    • Sialic acid-binding Ig-like lectin 6 antibody
    • SIGL6_HUMAN antibody
    • Siglec-6 antibody
    • SIGLEC6 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for SIGLEC6 using ab224406 at 1/1000 dilution in immunohistochemical analysis.

References

ab224406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up