Overview

  • Product name

  • Description

    Rabbit polyclonal to SIK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Pig, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to Human SIK1 aa 1-50 (N terminal).
    Sequence:

    MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK

  • Positive control

    • Jurkat cell lysate, Human stomach tissue
  • General notes

    This product was previously labelled as Snf1lk/SIK-1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab64428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 85 kDa (predicted molecular weight: 85 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. Potential role in G2/M cell cycle regulation. Inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the cytoplasm on phosphorylation where it binds binding to YWHAZ.
  • Information by UniProt
  • Database links

  • Alternative names

    • KID2 antibody
    • MSK antibody
    • myocardial SNF1 like kinase antibody
    • QIK antibody
    • Qin-induced kinase antibody
    • Salt inducible kinase 1 antibody
    • Salt-inducible protein kinase 1 antibody
    • Serine threonine protein kinase SNF1 like kinase 1 antibody
    • Serine threonine protein kinase SNF1LK antibody
    • Serine/threonine-protein kinase SIK1 antibody
    • Serine/threonine-protein kinase SNF1-like kinase 1 antibody
    • Serine/threonine-protein kinase SNF1LK antibody
    • SIK-1 antibody
    • SIK1 antibody
    • SIK1_HUMAN antibody
    • SNF1 like kinase antibody
    • Snf1lk antibody
    see all

Images

  • Anti-SIK1 antibody (ab64428) at 1.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 85 kDa
    Observed band size: 85 kDa



    Diluted in 5% skim milk / PBS buffer, gel concentration 12%
  • ab64428 at 4-8µg/ml staining surface mucous cells and epithelial cells of fundic gland from human stomach; paraffin embedded; magnification 400X.

References

This product has been referenced in:

  • Hong B  et al. Activation of the LKB1-SIK1 signaling pathway inhibits the TGF-ß-mediated epithelial-mesenchymal transition and apoptosis resistance of ovarian carcinoma cells. Mol Med Rep 17:2837-2844 (2018). Read more (PubMed: 29257268) »
  • Bai X  et al. MicroRNA-373 promotes cell migration via targeting salt-inducible kinase 1 expression in melanoma. Exp Ther Med 16:4759-4764 (2018). Read more (PubMed: 30542430) »
See all 5 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (Human HepG2 cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
15 µg
Specification
Human HepG2 cells
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 05 2016

Application
Western blot
Sample
Mouse Tissue lysate - whole (Mouse hypothalamus)
Gel Running Conditions
Reduced Denaturing (4-20% Tris-Hepes Gel)
Loading amount
5 µg
Specification
Mouse hypothalamus
Blocking step
Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Jul 26 2012

Answer

DISCOUNT CODES:

Test of the protein ab89693 for inhibition: ********
Test of the antibody ab64428 in Mouse: ********



Expiration date for both codes (extended due to the non-availability): ********


I am very pleased to hear you would like to accept our offer and test ab64428 in Mouse and 89693 for inhibition. Each code will give you 1 free primary antibody or a free protein or value off of order before the expiration date. To redeem this offer, please submit an Abreview for Mouse (ab64428) and inhibition test (ab89693) and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.
For more information on how to submit an Abreview, please visit the site: https://www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways:
1) Call to place your order and mention the code to our customer service department;
2) Include the code in your fax order;
3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up