Overview

  • Product name

  • Description

    Rabbit polyclonal to SIK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SIK2 aa 325-457.
    Sequence:

    HFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLP VTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVN GCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLE


    Database link: Q9H0K1

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as Snf1lk2, Snf1lk+Snf1lk2+SIK3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Phosphorylates 'Ser-794' of IRS1 in insulin-stimulated adipocytes, potentially modulating the efficiency of insulin signal transduction. Inhibits CREB activity by phosphorylating and repressing TORCs, the CREB-specific coactivators.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434K1115 antibody
    • EC 2.7.11.1 antibody
    • KIAA0781 antibody
    • LOH11CR1I antibody
    • QIK antibody
    • Qin induced kinase antibody
    • Qin-induced kinase antibody
    • Salt inducible kinase 2 antibody
    • Salt inducible protein kinase 2 antibody
    • Salt inducible serine/threonine kinase 2 antibody
    • Salt-inducible protein kinase 2 antibody
    • Serine/threonine protein kinase SIK2 antibody
    • Serine/threonine protein kinase SNF1 like kinase 2 antibody
    • Serine/threonine-protein kinase SIK2 antibody
    • Serine/threonine-protein kinase SNF1-like kinase 2 antibody
    • SIK 2 antibody
    • SIK-2 antibody
    • SIK2 antibody
    • SIK2_HUMAN antibody
    • SNF1 like kinase antibody
    • SNF1 like kinase 2 antibody
    • SNF1LK2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for SIK2 with ab244350 at a 1/20 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells labeling SIK2 using ab244350 at 4 µg/ml (green) in ICC/IF.

References

ab244350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up