Overview

  • Product name

    Anti-SIMPL antibody - C-terminal
    See all SIMPL primary antibodies
  • Description

    Rabbit polyclonal to SIMPL - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Human
  • Immunogen

    Synthetic peptide within Mouse SIMPL aa 210-259 (C terminal). The exact sequence is proprietary. (NP_075362)
    Sequence:

    WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL


    Database link: Q9ESJ7

  • Positive control

    • Mouse testis lysate.
  • General notes

     This product was previously labelled as IRAK1BP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab177813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity.
  • Sequence similarities

    Belongs to the IRAK1BP1 family.
  • Domain

    The intrinsically disordered region interacts with HSPA1 and HSPA8.
  • Post-translational
    modifications

    Phosphorylation at Ser-56 and/or Ser-62 is required for full activity. Phosphorylated on at least one of Ser-235, Thr-237, Ser-242 and Thr-247 upon TNF-alpha activation, which favors nuclear translocation.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ActA binding protein 3 antibody
    • AIP70 antibody
    • IKBP1_HUMAN antibody
    • Interleukin 1 receptor associated kinase 1 binding protein 1 antibody
    • Interleukin-1 receptor-associated kinase 1-binding protein 1 antibody
    • IRAK1-binding protein 1 antibody
    • IRAK1BP1 antibody
    • Signaling molecule that associates with Pelle-like kinase antibody
    • SIMPL antibody
    see all

Images

  • Anti-SIMPL antibody - C-terminal (ab177813) at 1 µg/ml + mouse testis lysate at 10 µg

    Predicted band size: 29 kDa

References

ab177813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up