Overview

  • Product name

  • Description

    Rabbit polyclonal to SIRT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human SIRT3 aa 1-339.
    Sequence:

    MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGL RGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRR SISFSVGASSVVGSGGSSDK GKLSLQDVAELIRARACQRVVVMVGAGI STPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKE LYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAH GTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPL PQ RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRD LVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDG PDK


    Database link: Q9NTG7

  • Positive control

    • HepG2 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 44 kDa.
IHC-P 1/20 - 1/50.

Target

  • Function

    NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the sirtuin family. Class I subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Post-translational
    modifications

    Processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Such processing is probably essential for its enzymatic activity.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • hSIRT 3 antibody
    • hSIRT3 antibody
    • Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase antibody
    • NAD dependent deacetylase sirtuin 3 mitochondrial antibody
    • NAD-dependent protein deacetylase sirtuin-3, mitochondrial antibody
    • Regulatory protein SIR2 homolog 3 antibody
    • Silent mating type information regulation 2 S.cerevisiae homolog 3 antibody
    • Sir 2 like 3 antibody
    • SIR 2 like protein 3 antibody
    • SIR 3 antibody
    • SIR2 L3 antibody
    • Sir2 like 3 antibody
    • SIR2 like protein 3 antibody
    • SIR2-like protein 3 antibody
    • SIR2L3 antibody
    • SIR3_HUMAN antibody
    • SIRT 3 antibody
    • SIRT3 antibody
    • Sirtuin 3 antibody
    • Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae) antibody
    • Sirtuin type 3 antibody
    • Sirtuin3 antibody
    see all

Images

  • Anti-SIRT3 antibody (ab189860) at 1/500 dilution + HepG2 cell extract

    Predicted band size: 44 kDa

References

This product has been referenced in:

  • Rezzani R  et al. A carnosine analog with therapeutic potentials in the treatment of disorders related to oxidative stress. PLoS One 14:e0215170 (2019). Read more (PubMed: 30964920) »
  • Gao J  et al. Trilobatin Protects Against Oxidative Injury in Neuronal PC12 Cells Through Regulating Mitochondrial ROS Homeostasis Mediated by AMPK/Nrf2/Sirt3 Signaling Pathway. Front Mol Neurosci 11:267 (2018). Read more (PubMed: 30104959) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up