Overview

  • Product name

  • Description

    Rabbit polyclonal to SIRT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human SIRT5 aa 1-310.
    Sequence:

    MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKA KHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWE FYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAG TKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIP VEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGT SSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA LACHENETVS


    Database link: Q9NXA8

  • Positive control

    • Recombinant Human SIRT5 protein

Properties

Applications

Our Abpromise guarantee covers the use of ab195436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2500 - 1/3000. Detects a band of approximately 29 kDa (predicted molecular weight: 34 kDa).

Target

  • Function

    NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed:21908771, PubMed:22076378, PubMed:24703693). Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting (PubMed:22076378, PubMed:24703693). Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species (PubMed:24140062). Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the sirtuin family. Class III subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Domain

    In contrast to class I sirtuins, class III sirtuins have only weak deacetylase activity. Difference in substrate specificity is probably due to a larger hydrophobic pocket with 2 residues (Tyr-102 and Arg-105) that bind to malonylated and succinylated substrates and define the specificity (PubMed:22076378).
  • Cellular localization

    Mitochondrion; Cytoplasm. Mitochondrion and Mitochondrion matrix. Mitochondrion intermembrane space. Cytoplasm, cytosol. Nucleus. Mainly mitochondrial. Also present extramitochondrially: a fraction is present in the cytosol and very small amounts are also detected in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NAD dependent deacetylase sirtuin 5 antibody
    • NAD dependent lysine demalonylase and desuccinylase sirtuin 5 mitochondrial antibody
    • NAD dependent protein deacylase sirtuin 5 mitochondrial antibody
    • NAD-dependent protein deacylase sirtuin-5, mitochondrial antibody
    • Regulatory protein SIR2 homolog 5 antibody
    • Silent mating type information regulation 2 S.cerevisiae homolog 5 antibody
    • Sir2 like 5 antibody
    • SIR2-like protein 5 antibody
    • SIR2L5 antibody
    • SIR5_HUMAN antibody
    • Sirt5 antibody
    • Sirtuin 5 antibody
    • Sirtuin type 5 antibody
    see all

Images

  • All lanes : Anti-SIRT5 antibody (ab195436) at 1/2500 dilution

    Lane 1 : Recombinant Human SIRT5 (His-tag)
    Lane 2 : Recombinant Human SIRT3 (His-tag)
    Lane 3 : Recombinant Human SIRT2 (His-tag)
    Lane 4 : Recombinant Human SIRT1 (His-tag)

    Predicted band size: 34 kDa
    Observed band size: 29 kDa
    why is the actual band size different from the predicted?

  • All lanes : Anti-SIRT5 antibody (ab195436) at 1/2500 dilution

    Lane 1 : Recombinant Human SIRT5 (His-tag)
    Lane 2 : Recombinant Human SIRT3 (His-tag)
    Lane 3 : Recombinant Human SIRT2 (His-tag)
    Lane 4 : Recombinant Human SIRT1 (His-tag)

    Predicted band size: 34 kDa
    Observed band size: 29 kDa why is the actual band size different from the predicted?

References

ab195436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up