Overview

  • Product name

  • Description

    Rabbit polyclonal to Six3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Six3 aa 267-328.
    Sequence:

    KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADT GTSILSVTSSDS


    Database link: O95343

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in visual system development.
  • Involvement in disease

    Defects in SIX3 are the cause of holoprosencephaly type 2 (HPE2) [MIM:157170]. Holoprosencephaly (HPE) [MIM:236100] is the most common structural anomaly of the brain, in which the developing forebrain fails to correctly separate into right and left hemispheres. Holoprosencephaly is genetically heterogeneous and associated with several distinct facies and phenotypic variability.
  • Sequence similarities

    Belongs to the SIX/Sine oculis homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein SIX3 antibody
    • HPE2 antibody
    • Sine oculis homeobox homolog 3 antibody
    • SIX homeobox 3 antibody
    • Six3 antibody
    • SIX3_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for Six3 (green) using ab221750 at 4 µg/ml in ICC/IF. 

References

ab221750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up