Overview

  • Product name
    Anti-SIX4 antibody
  • Description
    Rabbit polyclonal to SIX4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human SIX4 aa 731-781 (C terminal). The exact sequence is proprietary.
    Sequence:

    SKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD L


    Database link: Q9UIU6

  • Positive control
    • WB: HeLa and 293T whole cell lysates. IP HeLa whole cell lysate (ab150035).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.2% BSA

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 83 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Sequence similarities
    Belongs to the SIX/Sine oculis homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AREC 3 antibody
    • AREC3 antibody
    • Homeobox protein SIX4 antibody
    • MGC119450 antibody
    • MGC119452 antibody
    • MGC119453 antibody
    • Sine oculis homeobox homolog 4 antibody
    • SIX homeobox 4 antibody
    • Six4 antibody
    • SIX4_HUMAN antibody
    see all

Images

  • All lanes : Anti-SIX4 antibody (ab176713) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 83 kDa


    Exposure time: 30 seconds
  • SIX4 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176713 at 6 μg/mg lysate (Lane 2), a rabbit anti-SIX4 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176713 at 0.4 μg/ml.

    Detection: Chemiluminescence with exposure time of 3 seconds.

References

ab176713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up