Overview

  • Product name

  • Description

    Rabbit polyclonal to SKAP55
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse SKAP55 aa 1-355. Expressed in E.coli. N-terminal tags.
    Sequence:

    MQAVALPEEICWLLEDTEDFLAEGLQNENLSPGAQDQRAHILRGFQQIKS RYCWDFQPQGGDLGQDGSDDNLSGTHGPPLTSEASFWSDYQDEGIEDILR GAQELDSVIKQGYLEKKSKDHSFFGSEWQKRWCVISRGLFLYYANEKSKQ PKGTFLIKGYSVRMAPHLRKDSKKESCFELISQDRRSYEFTASSPAEARD WVDQISFLLKDLSSLTIPFEEEEEEEEEEEKEEEEMYNDVDGFDSPRSGS QCRAMALPEPTEKEEDIYEVLPDDDDLEEDTCGAHRRRVDYADYYQGLWD CHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSVIGIVPKDYLTTAF EMEGI


    Database link: Q3UUV5

  • Positive control

    • WB: Recombinant mouse SKAP55; mouse thymus and spleen lysates; rat thymus lysate. IHC-P: Mouse spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Function

    Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.
  • Tissue specificity

    Highly expressed in thymocytes and peripheral blood lymphocytes. Also expressed in spleen cells and testis. Present in T-cells (at protein level).
  • Sequence similarities

    Belongs to the SKAP family.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain interacts with FYB.
  • Post-translational
    modifications

    Phosphorylated on tyrosines. Phosphorylation by FYN on Tyr-271 is required for GRB2 interaction. Phosphorylation by FYN on Tyr-295 abolishes interaction with FYB. Tyr-232 is dephosphorylated by PTPRC.
  • Cellular localization

    Cytoplasm. Nucleus. Cell membrane. Upon T-cell stimulation, translocates to lipid rafts at the cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • pp55 antibody
    • SCAP 1 antibody
    • SCAP1 antibody
    • SKAP 1 antibody
    • SKAP 55 antibody
    • SKAP-55 antibody
    • Skap1 antibody
    • SKAP1_HUMAN antibody
    • SKAP55 adaptor protein antibody
    • SRC family associated phosphoprotein 1 antibody
    • Src family-associated phosphoprotein 1 antibody
    • Src kinase associated phosphoprotein 1 antibody
    • SRC kinase associated phosphoprotein 55 kD antibody
    • Src kinase associated phosphoprotein of 55 kDa antibody
    • Src kinase-associated phosphoprotein 1 antibody
    • Src kinase-associated phosphoprotein of 55 kDa antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for SKAP55 using ab231279 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SKAP55 antibody (ab231279) at 2 µg/ml + Mouse thymus lysate

    Predicted band size: 41 kDa

  • Anti-SKAP55 antibody (ab231279) at 2 µg + Rat thymus lysate

    Predicted band size: 41 kDa

  • Anti-SKAP55 antibody (ab231279) at 2 µg/ml + Mouse spleen lysate

    Predicted band size: 41 kDa

  • Anti-SKAP55 antibody (ab231279) at 2 µg/ml + Recombinant mouse SKAP55 protein

    Predicted band size: 41 kDa

References

ab231279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up