Overview

  • Product name

    Anti-Skeletrophin / Mib2 antibody
    See all Skeletrophin / Mib2 primary antibodies
  • Description

    Rabbit polyclonal to Skeletrophin / Mib2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Skeletrophin/ Mib2 aa 407-663. (NM_001005901.2; Expressed in E.coli).
    Sequence:

    ENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVD TKNQGRTALQVAAYLGQVELVRLLLQARASVDLLDEEGNTALHYTAMGNQ PEATRLLLSAGCGVDAQNGTRSTALHVAVQRGFLEVVKILCEHGCDVNLP DAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLK GHVLAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQVLIREGRCD VNVRNRK

  • Positive control

    • WB: Recombinant rat Skeletrophin / Mib2 protein; HEK-293T and HeLa cell lysates. IHC-P: Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233069 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 106 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Skeletrophin, also known as Mib2, is a homolog of the zebrafish protein Mindbomb. Skeletrophin is an E3 ubiquitin ligase, expressed mainly in skeletal muscle, which is downregulated in malignant melanoma.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase MIB2 antibody
    • Mib2 antibody
    • Mindbomb homolog 2 antibody
    • Novel zinc finger protein antibody
    • Novelzin antibody
    • Putative NF-kappa-B-activating protein 002N antibody
    • SKD antibody
    • Skeletrophin antibody
    • Zinc finger ZZ type with ankyrin repeat domain protein 1 antibody
    • ZZANK1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for Skeletrophin / Mib2 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Skeletrophin / Mib2 antibody (ab233069) at 2 µg/ml + Recombinant rat Skeletrophin / Mib2 protein

    Predicted band size: 106 kDa

  • Anti-Skeletrophin / Mib2 antibody (ab233069) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 106 kDa

  • Anti-Skeletrophin / Mib2 antibody (ab233069) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 106 kDa

References

ab233069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up