Overview

  • Product name

  • Description

    Rabbit polyclonal to Skp1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Chicken, Guinea pig, Cow, Xenopus laevis, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Skp1 aa 1-163. (Expressed in E.coli).
    Sequence:

    MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNV NAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTL FELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEE AQVRKENQWCEEK


    Database link: P63208

  • Positive control

    • IHC-P: Human cerebrum, glioma, liver and kidney tissues. WB: HEK-293T cell lysate; Rat and pig brain lysates; Recombinant human Skp1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Function

    Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(Cyclin F) directs ubiquitination of CP110.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the SKP1 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cyclin A/CDK2 associated p19 antibody
    • Cyclin A/CDK2 associated protein p19 antibody
    • Cyclin-A/CDK2-associated protein p19 antibody
    • EMC19 antibody
    • MGC34403 antibody
    • OCP 2 antibody
    • OCP II antibody
    • OCP II protein antibody
    • OCP-2 antibody
    • OCP-II antibody
    • OCP2 antibody
    • OCPII antibody
    • Organ of Corti protein 2 antibody
    • Organ of Corti protein II antibody
    • OTTHUMP00000159379 antibody
    • OTTHUMP00000159380 antibody
    • OTTHUMP00000228275 antibody
    • OTTHUMP00000228276 antibody
    • OTTHUMP00000228278 antibody
    • OTTHUMP00000228279 antibody
    • OTTHUMP00000228281 antibody
    • p19A antibody
    • p19skp1 antibody
    • RNA polymerase II elongation factor like protein antibody
    • RNA polymerase II elongation factor like protein OCP2 antibody
    • RNA polymerase II elongation factor-like protein antibody
    • S phase kinase associated protein 1 antibody
    • S phase kinase associated protein 1A antibody
    • S phase kinase associated protein 1A p19A antibody
    • S-phase kinase-associated protein 1 antibody
    • SIII antibody
    • Skp 1 antibody
    • SKP 1A antibody
    • skp1 antibody
    • SKP1_HUMAN antibody
    • SKP1A antibody
    • TCEB1L antibody
    • Transcription Elongation Factor B 1 like antibody
    • Transcription elongation factor B antibody
    • Transcription elongation factor B SIII polypeptide 1 like antibody
    see all

Images

  • Paraffin-embedded human cerebrum tissue stained for Skp1 using ab233484 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Skp1 using ab233484 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for Skp1 using ab233484 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Skp1 using ab233484 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Skp1 antibody (ab233484) at 2 µg/ml + Recombinant human Skp1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 19 kDa

  • All lanes : Anti-Skp1 antibody (ab233484) at 2 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Pig brain lysate
    Lane 3 : Rat brainl lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 19 kDa

References

ab233484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up