Overview

  • Product name

  • Description

    Rabbit polyclonal to SKP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human SKP2 aa 383-424 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL


    Database link: Q13309

  • Positive control

    • Human thyroid carcinoma tissue; MCF-7 cells; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab216687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
Flow Cyt 1/100.
ICC/IF 1/500.
WB 1/500.

Target

  • Function

    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, MLL, CDK9, RAG2, FOXO1A, UBP43, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 9 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDK2/Cyclin A associated protein p45 antibody
    • Cyclin A/CDK2 associated protein p45 antibody
    • Cyclin-A/CDK2-associated protein p45 antibody
    • F box protein Skp2 antibody
    • F box/LRR repeat protein 1 antibody
    • F-box protein Skp2 antibody
    • F-box/LRR-repeat protein 1 antibody
    • FBL 1 antibody
    • FBL1 antibody
    • FBXL 1 antibody
    • FBXL1 antibody
    • FLB 1 antibody
    • FLB1 antibody
    • MGC1366 antibody
    • p45 antibody
    • p45skp2 antibody
    • S phase kinase associated protein 2 (p45) antibody
    • S phase kinase associated protein 2 antibody
    • S-phase kinase-associated protein 2 antibody
    • S-phase kinase-associated protein 2 E3 ubiquitin protein ligase antibody
    • SKP 2 antibody
    • Skp2 antibody
    • SKP2_HUMAN antibody
    see all

Images

  • Anti-SKP2 antibody (ab216687) at 1/500 dilution + 293T lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human thyroid carcinoma tissue labeling SKP2 with ab216687 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunofluorescent analysis of MCF-7 cells labeling SKP2 with ab216687 at 1/500 dilution in PBS for two hours at 37°C, followed by Goat anti-rabbit IgG (H+L), Cy3 conjugated secondary antibody. The nucleus was stained with DAPI.

  • Flow cytometric analysis of HeLa cells labeling SKP2 with ab 216687 at 1/100 dilution for 30 minutes followed by a PE conjugated secondary antibody (green), compared to unstained cells (blue), secondary only (light blue), and an isotype control (orange).

References

ab216687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up