Overview

  • Product name

  • Description

    Rabbit polyclonal to SLAMF6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Mouse SLAMF6 aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKD S


    Database link: Q9ET39-2

  • Positive control

    • Mouse renal tubular endothelial tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab213690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors.
  • Tissue specificity

    Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating NK receptor antibody
    • CD352 antibody
    • KALI antibody
    • KALIb antibody
    • LY108 antibody
    • MGC104953 antibody
    • Natural killer T and B cell antigen antibody
    • NK T B antigen antibody
    • NK-, T-, and B-cell antigen antibody
    • NK-T-B-antigen antibody
    • NTB A antibody
    • NTB-A antibody
    • NTBA antibody
    • NTBA receptor antibody
    • SF2000 antibody
    • SLAF6_HUMAN antibody
    • SLAM family member 6 antibody
    • SLAM family member 6 precursor antibody
    • SLAM Family Receptor antibody
    • Slamf6 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse renal tubular endothelial tissue labeling SLAMF6 with ab213690 at 1/100 dilution, followed by conjugation to a secondary antibody and DAB staining.

References

ab213690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up