Overview

  • Product name

  • Description

    Rabbit polyclonal to SLAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLAP2 aa 24-115.
    Sequence:

    GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLS EVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG


    Database link: Q9H6Q3

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • A930009E21Rik antibody
    • AI430952 antibody
    • C20orf156 antibody
    • FLJ21992 antibody
    • MARS antibody
    • MGC49845 antibody
    • Modulator of antigen receptor signaling antibody
    • RGD1562071 antibody
    • SLA 2 antibody
    • SLA2 antibody
    • SLAP 2 antibody
    • SLAP-2 antibody
    • SLAP2 antibody
    • SLAP2_HUMAN antibody
    • Src like adapter protein 2 antibody
    • Src like adaptor 2 antibody
    • Src-like adapter protein 2 antibody
    • Src-like-adapter 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLAP2 (green) using ab222381 at 4 µg/ml in ICC/IF.

References

ab222381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up