Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC10A3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC10A3 aa 81-221.
    Sequence:

    DSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNVSAITWGGGGG FVVSIHSGLAGLAPLHIQLVDAHEAPPTLIEERRDFCIKVSPAEDTPATL SADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQ


    Database link: P09131

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human urinary bladder tissue.
  • General notes

    This product was previously labelled as P3 protein

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    The ubiquitous expression and the conservation of the sequence in distant animal species suggest that the gene codes for a protein with housekeeping functions.
  • Sequence similarities

    Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DXS253E antibody
    • P3 antibody
    • P3 protein antibody
    • P3_HUMAN antibody
    • Slc10a3 antibody
    • Solute carrier family 10 (sodium/bile acid cotransporter family) member 3 antibody
    • Solute carrier family 10 member 3 antibody
    see all

Images

  • Paraffin-embedded human urinary bladder tissue stained for SLC10A3 using ab224438 at 1/1000 dilution in immunohistochemical analysis.

  • Anti-SLC10A3 antibody (ab224438) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 50 kDa

References

ab224438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up