Anti-SLC12A3 antibody (ab224762)
Key features and details
- Rabbit polyclonal to SLC12A3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLC12A3 antibody
See all SLC12A3 primary antibodies -
Description
Rabbit polyclonal to SLC12A3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human SLC12A3 aa 844-988.
Sequence:LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEV HILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISD EEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Database link: P55017 -
Positive control
- IHC-P: Human kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224762 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Electrically silent transporter system. Mediates sodium and chloride reabsorption. -
Tissue specificity
Predominant in kidney. -
Involvement in disease
Defects in SLC12A3 are the cause of Gitelman syndrome (GS) [MIM:263800]. GS is an autosomal recessive disorder characterized by hypokalemic alkalosis in combination with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. Patients are often asymptomatic or present transient periods of muscular weakness and tetany, usually accompanied by abdominal pain, vomiting and fever. The phenotype is highly heterogeneous in terms of age at onset and severity. Cardinal features such as hypocalciuria and hypomagnesemia might also change during the life cycle of a given patient. GS has overlapping features with Bartter syndrome. -
Sequence similarities
Belongs to the SLC12A transporter family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6559 Human
- Entrez Gene: 20497 Mouse
- Omim: 600968 Human
- SwissProt: P55017 Human
- SwissProt: P59158 Mouse
- Unigene: 669115 Human
- Unigene: 25804 Mouse
-
Alternative names
- FLJ96318 antibody
- Na Cl cotransporter antibody
- Na Cl symporter antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC12A3 antibody (ab224762)Paraffin-embedded human kidney tissue stained for SLC12A3 using ab224762 at 1/50 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab224762 has been referenced in 1 publication.
- Carrisoza-Gaytan R et al. Intercalated cell BKa subunit is required for flow-induced K+ secretion. JCI Insight 5:N/A (2020). PubMed: 32255763
