Anti-SLC12A3 antibody (ab224762)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SLC12A3 antibody
See all SLC12A3 primary antibodies -
Description
Rabbit polyclonal to SLC12A3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human SLC12A3 aa 844-988.
Sequence:LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEV HILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISD EEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Database link: P55017 -
Positive control
- IHC-P: Human kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224762 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Electrically silent transporter system. Mediates sodium and chloride reabsorption. -
Tissue specificity
Predominant in kidney. -
Involvement in disease
Defects in SLC12A3 are the cause of Gitelman syndrome (GS) [MIM:263800]. GS is an autosomal recessive disorder characterized by hypokalemic alkalosis in combination with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. Patients are often asymptomatic or present transient periods of muscular weakness and tetany, usually accompanied by abdominal pain, vomiting and fever. The phenotype is highly heterogeneous in terms of age at onset and severity. Cardinal features such as hypocalciuria and hypomagnesemia might also change during the life cycle of a given patient. GS has overlapping features with Bartter syndrome. -
Sequence similarities
Belongs to the SLC12A transporter family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6559 Human
- Entrez Gene: 20497 Mouse
- Omim: 600968 Human
- SwissProt: P55017 Human
- SwissProt: P59158 Mouse
- Unigene: 669115 Human
- Unigene: 25804 Mouse
-
Alternative names
- FLJ96318 antibody
- Na Cl cotransporter antibody
- Na Cl symporter antibody
see all
Images
Datasheets and documents
References
ab224762 has not yet been referenced specifically in any publications.