Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC12A3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human SLC12A3 aa 3-146. N-terminal tag. Expressed in E.coli
    Sequence:

    ELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFC MRTFGYNTIDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHA LAFDSRPSHEMTDGLVEGEAGTSSEKNPEEPVRFGWVKGVMIRC


    Database link: P55017

  • Positive control

    • IHC-P: Human breast, kidney, colorectal cancer, glioma, liver and stomach tissues. WB: Recombinant human SLC12A3 protein; Pig kidney lysate; HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Electrically silent transporter system. Mediates sodium and chloride reabsorption.
  • Tissue specificity

    Predominant in kidney.
  • Involvement in disease

    Defects in SLC12A3 are the cause of Gitelman syndrome (GS) [MIM:263800]. GS is an autosomal recessive disorder characterized by hypokalemic alkalosis in combination with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. Patients are often asymptomatic or present transient periods of muscular weakness and tetany, usually accompanied by abdominal pain, vomiting and fever. The phenotype is highly heterogeneous in terms of age at onset and severity. Cardinal features such as hypocalciuria and hypomagnesemia might also change during the life cycle of a given patient. GS has overlapping features with Bartter syndrome.
  • Sequence similarities

    Belongs to the SLC12A transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ96318 antibody
    • Na Cl cotransporter antibody
    • Na Cl symporter antibody
    • Na-Cl symporter antibody
    • NaCl electroneutral thiazide sensitive cotransporter antibody
    • NCC antibody
    • NCCT antibody
    • S12A3_HUMAN antibody
    • slc12a3 antibody
    • Solute carrier family 12 (sodium/chloride transporters) member 3 antibody
    • Solute carrier family 12 member 3 antibody
    • Thiazide sensitive Na Cl cotransporter antibody
    • Thiazide sensitive sodium chloride cotransporter antibody
    • Thiazide-sensitive sodium-chloride cotransporter antibody
    • TSC antibody
    see all

Images

  • All lanes : Anti-SLC12A3 antibody (ab233401) at 1 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Pig kidney tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Formalin-fixed, paraffin-embedded human stomach tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for SLC12A3 using ab233401 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-SLC12A3 antibody (ab233401) at 2 µg/ml + Recombinant human SLC12A3 protein

References

ab233401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up