Overview

  • Product name

    Anti-SLC12A3 antibody - C-terminal
    See all SLC12A3 primary antibodies
  • Description

    Rabbit polyclonal to SLC12A3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human SLC12A3 aa 960-1010 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    NEIVLDYSRDAALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIR G


    Database link: P55017

  • Positive control

    • Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab203674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution range is 1/50-1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 113 kDa.

Target

  • Function

    Electrically silent transporter system. Mediates sodium and chloride reabsorption.
  • Tissue specificity

    Predominant in kidney.
  • Involvement in disease

    Defects in SLC12A3 are the cause of Gitelman syndrome (GS) [MIM:263800]. GS is an autosomal recessive disorder characterized by hypokalemic alkalosis in combination with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. Patients are often asymptomatic or present transient periods of muscular weakness and tetany, usually accompanied by abdominal pain, vomiting and fever. The phenotype is highly heterogeneous in terms of age at onset and severity. Cardinal features such as hypocalciuria and hypomagnesemia might also change during the life cycle of a given patient. GS has overlapping features with Bartter syndrome.
  • Sequence similarities

    Belongs to the SLC12A transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ96318 antibody
    • Na Cl cotransporter antibody
    • Na Cl symporter antibody
    • Na-Cl symporter antibody
    • NaCl electroneutral thiazide sensitive cotransporter antibody
    • NCC antibody
    • NCCT antibody
    • S12A3_HUMAN antibody
    • slc12a3 antibody
    • Solute carrier family 12 (sodium/chloride transporters) member 3 antibody
    • Solute carrier family 12 member 3 antibody
    • Thiazide sensitive Na Cl cotransporter antibody
    • Thiazide sensitive sodium chloride cotransporter antibody
    • Thiazide-sensitive sodium-chloride cotransporter antibody
    • TSC antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling SLC12A3 with ab203674 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up