Description

  • Product name

    SLC12A3 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC
    • Amino acids

      980 to 1029

Associated products

Specifications

Our Abpromise guarantee covers the use of ab203575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-SLC12A3 antibody (ab99097)

  • Form

    Liquid
  • Additional notes

    This is the blocking peptide for ab99097

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

General Info

  • Alternative names

    • FLJ96318
    • Na Cl cotransporter
    • Na Cl symporter
    • Na-Cl symporter
    • NaCl electroneutral thiazide sensitive cotransporter
    • NCC
    • NCCT
    • S12A3_HUMAN
    • slc12a3
    • Solute carrier family 12 (sodium/chloride transporters) member 3
    • Solute carrier family 12 member 3
    • Thiazide sensitive Na Cl cotransporter
    • Thiazide sensitive sodium chloride cotransporter
    • Thiazide-sensitive sodium-chloride cotransporter
    • TSC
    see all
  • Function

    Electrically silent transporter system. Mediates sodium and chloride reabsorption.
  • Tissue specificity

    Predominant in kidney.
  • Involvement in disease

    Defects in SLC12A3 are the cause of Gitelman syndrome (GS) [MIM:263800]. GS is an autosomal recessive disorder characterized by hypokalemic alkalosis in combination with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. Patients are often asymptomatic or present transient periods of muscular weakness and tetany, usually accompanied by abdominal pain, vomiting and fever. The phenotype is highly heterogeneous in terms of age at onset and severity. Cardinal features such as hypocalciuria and hypomagnesemia might also change during the life cycle of a given patient. GS has overlapping features with Bartter syndrome.
  • Sequence similarities

    Belongs to the SLC12A transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab203575 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up