Overview

  • Product name

    Anti-SLC13A4/SUT1 antibody
  • Description

    Rabbit polyclonal to SLC13A4/SUT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC13A4/SUT1 aa 134-273.
    Sequence:

    LSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDV KNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQ HPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSIS


    Database link: Q9UKG4

  • Positive control

    • WB: HEK-293T whole cell lysate. IHC-P: Human testis and placenta tissue. ICC/IF: HEK-293 cells.
  • General notes

     This product was previously labelled as SLC13A4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
  • Tissue specificity

    Highly expressed in placenta and testis with intermediate levels in brain and lower levels in heart, thymus and liver.
  • Sequence similarities

    Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Na(+)/sulfate cotransporter SUT-1 antibody
    • NaS2 antibody
    • S13A4_HUMAN antibody
    • SLC13A4 antibody
    • Solute carrier family 13 member 4 antibody
    • SUT1 antibody
    see all

Images

  • Anti-SLC13A4/SUT1 antibody (ab236619) at 1/500 dilution + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human placenta tissue stained for SLC13A4/SUT1 with ab236619 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for SLC13A4/SUT1 with ab236619 at a 1/100 dilution in immunohistochemical analysis.

  • HEK-293 (Human epithelial cell line from embryonic kidney) cells stained for SLC13A4/SUT1 (Green) using ab236619 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up