Overview

  • Product name

    Anti-SLC16A3/MCT 4 antibody
    See all SLC16A3/MCT 4 primary antibodies
  • Description

    Rabbit polyclonal to SLC16A3/MCT 4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC16A3/MCT 4 aa 406-465.
    Sequence:

    NFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNG EVVHTPETSV


    Database link: O15427

  • Positive control

    • WB: Mouse stomach and skeletal muscle tissue. ICC/IF: HepG2 cells.
  • General notes

    Protein previously labeled as SLC16A3.

Properties

Applications

Our Abpromise guarantee covers the use of ab234728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).
ICC/IF 1/50 - 1/200.

Target

  • Function

    Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
  • Tissue specificity

    Highly expressed in skeletal muscle.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Form

    Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. The MCTs, which include MCT1 and MCT2, are characterized by 12 predicted transmembrane domains.
  • Alternative names

    • MCT 4 antibody
    • MCT3 antibody
    • MCT4 antibody
    • Monocarboxylate transporter 3 antibody
    • Monocarboxylate transporter 4 antibody
    • MOT4_HUMAN antibody
    • SLC16A3 antibody
    • Solute carrier family 16 member 3 antibody
    see all

Images

  • All lanes : Anti-SLC16A3/MCT 4 antibody (ab234728) at 1/500 dilution

    Lane 1 : Mouse stomach tissue lysate
    Lane 2 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLC16A3/MCT 4 using ab234728 at a dilution of 1/100 in ICC/IF. Secondary antibody is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up