Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC19A3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human SLC19A3 aa 191-282.
    Sequence:

    PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILST SGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWS


    Database link: Q9BZV2

  • Positive control

    • WB: SH-SY5Y, HepG2, HEK-293 and HeLa whole cell lysate (ab150035). ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 56 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    SLC19A3 is a member of the reduced folate family of micronutrient transporter genes. It is a ubiquitously expressed transmembrane thiamine transporter that lacks folate transport activity yet mediates high affinity thiamine uptake propably via a proton anti-port mechanism. Mutations in this gene cause biotin-responsive basal ganglia disease (BBGD); a recessive disorder manifested in childhood that progresses to chronic encephalopathy, dystonia, quadriparesis, and death if untreated. Patients with BBGD have bilateral necrosis in the head of the caudate nucleus and in the putamen. Mutations in this gene also cause a Wernicke's-like encephalopathy.
  • Cellular localization

    Plasma membrane
  • Database links

  • Alternative names

    • Solute carrier family 19 member 3 antibody
    • Thiamine transporter 2 antibody
    • thTr 2 antibody
    • THTR2 antibody

Images

  • All lanes : Anti-SLC19A3 antibody (ab237630) at 1/500 dilution

    Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLC19A3 (green) using ab237630 at 1/166 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

References

ab237630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up